Skip to Content

ELISA Recombinant Fowlpox virus Protein L1 homolog (FPV128)

https://www.scicommhub.com/web/image/product.template/127465/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Fowlpox virus (strain NVSL) (FPV) Uniprot NO.:P15910 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GAAASIQTTVTTINKKISEKLEQTASASATANCDINIGNIIFKKNKGCNVLVKNMCSANA SAQLDAIVSAVREVYDQLTEQQKAYAPSLLTAALNIQTNVSTITQDFETYIKQKCNSDAV INNIINVQSLEVDECSAPPGQIMTFEFINTGTATGNCAMKSVLDVLTKSSDRVSGNQSTG NDFSKYLYIIGGIICFLILLYYAKKLFFMSTNDKVKVLLAKKPDVHWTTYIDTYFRSSPV LV Protein Names:Recommended name: Protein L1 homolog Alternative name(s): Virion membrane protein M25 Gene Names:Ordered Locus Names:FPV128 ORF Names:FP2 Expression Region:2-243 Sequence Info:fµLl length protein

1,590.00 € 1590.0 EUR 1,590.00 €

1,590.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.