Skip to Content

ELISA Recombinant Escherichia coli Respiratory nitrate reductase 1 gamma chain(narI)

https://www.scicommhub.com/web/image/product.template/126164/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P11350 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQFLNMFFFDIYPYIAGAVFLIGSWLRYDYGQYTWRAASSQmLDRKGMNLASNLFHIGIL GIFVGHFFGmLTPHWMYEAWLPIEVKQKMAMFAGGASGVLCLIGGVLLLKRRLFSPRVRA TTTGADILILSLLVIQCALGLLTIPFSAQHMDGSEMMKLVGWAQSVVTFHGGASQHLDGV AFIFRLHLVLGMTLFLLFPFSRLIHIWSVPVEYLTRKYQLVRARH Protein Names:Recommended name: Respiratory nitrate reductase 1 gamma chain EC= 1.7.99.4 Alternative name(s): Cytochrome B-NR Nitrate reductase A subunit gamma Quinol-nitrate oxidoreductase subunit gamma Gene Names:Name:narI Synonyms:chlI Ordered Locus Names:b1227, JW1218 Expression Region:1-225 Sequence Info:fµLl length protein

1,572.00 € 1572.0 EUR 1,572.00 €

1,572.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days