ELISA Recombinant Exopolysaccharide production repressor protein(exoX)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium leguminosarum bv. phaseoli
Uniprot NO.:P14801
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHQRCFGLRASLSIFKAFAVTLAASVFLQVVYFLSLLFMSFRPTRESDRSIHSGTRQADQ PQKRDRDKTEQSNVPKLDPRRKRRTP
Protein Names:Recommended name: Exopolysaccharide production repressor protein Alternative name(s): Polysaccharide inhibition protein
Gene Names:Name:exoX Synonyms:psi, psiA
Expression Region:1-86
Sequence Info:fµLl length protein