ELISA Recombinant Exopolysaccharide production repressor protein(exoX)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium leguminosarum bv. phaseoli Uniprot NO.:P14801 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHQRCFGLRASLSIFKAFAVTLAASVFLQVVYFLSLLFMSFRPTRESDRSIHSGTRQADQ PQKRDRDKTEQSNVPKLDPRRKRRTP Protein Names:Recommended name: Exopolysaccharide production repressor protein Alternative name(s): Polysaccharide inhibition protein Gene Names:Name:exoX Synonyms:psi, psiA Expression Region:1-86 Sequence Info:fµLl length protein