ELISA Recombinant Flagellar biosynthetic protein FliQ(fliQ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Clostridium tetani Uniprot NO.:P0CF98 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSENMIMGVMRDAISTGLLVSAPILISAIVVGLLISILQATTQIQEQTLTFVPKLITVAL VGLFTGNWmLHNLVGLTNRIFELIANIVK Protein Names:Recommended name: Flagellar biosynthetic protein FliQ Gene Names:Name:fliQ Ordered Locus Names:CTC_01661 Expression Region:1-89 Sequence Info:fµLl length protein