ELISA Recombinant Escherichia coli Protein-export membrane protein SecG(secG)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:P0AG99
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYEALLVVFLIVAIGLVGLImLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN
Protein Names:Recommended name: Protein-export membrane protein SecG Alternative name(s): P12 Preprotein translocase band 1 subunit
Gene Names:Name:secG Ordered Locus Names:b3175, JW3142
Expression Region:1-110
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF314852ENV
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.