ELISA Recombinant Escherichia coli Protein-export membrane protein SecG(secG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AG99 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYEALLVVFLIVAIGLVGLImLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN Protein Names:Recommended name: Protein-export membrane protein SecG Alternative name(s): P12 Preprotein translocase band 1 subunit Gene Names:Name:secG Ordered Locus Names:b3175, JW3142 Expression Region:1-110 Sequence Info:fµLl length protein