ELISA Recombinant Escherichia coli Phosphate transport system permease protein pstC(pstC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0AGH8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAATKPAFNPPGKKGDIIFSVLVKLAALIVLLmLGGIIVSLIISSWPSIQKFGLAFLWTK EWDAPNDIYGALVPIYGTLVTSFIALLIAVPVSFGIALFLTELAPGWLKRPLGIAIELLA AIPSIVYGMWGLFIFAPLFAVYFQEPVGNIMSNIPIVGALFSGPAFGIGILAAGVILAIM IIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGGImLGLGRALG ETMAVTFIIGNTYQLDSASLYMPGNSITSALANEFAEAESGLHVAALMELGLILFVITFI VLAASKFMIMRLAKNEGAR Protein Names:Recommended name: Phosphate transport system permease protein pstC Gene Names:Name:pstC Synonyms:phoW Ordered Locus Names:b3727, JW3705 Expression Region:1-319 Sequence Info:fµLl length protein