ELISA Recombinant Escherichia coli Phosphotransferase enzyme IIB component glvB(glvB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P69789 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFSNHADMmLTQIAIGLCFTLLYFVVFRTLILQFNMCTPGREDAEVKLYSKAEYKASRGQ TTAAEPKKELDQAAGILQALGGVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGV FRSGDAIQVIIGLHVSQLREQLDSLINSHQSAENVAITEAV Protein Names:Recommended name: Phosphotransferase enzyme IIB component glvB EC= 2.7.1.69 Alternative name(s): PTS system EIIB component Gene Names:Name:glvB Synonyms:glvC Ordered Locus Names:b3682, JW3659 Expression Region:1-161 Sequence Info:fµLl length protein