Skip to Content

ELISA Recombinant Escherichia coli Putative diguanylate cyclase YeaJ(yeaJ)

https://www.scicommhub.com/web/image/product.template/126131/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P76237 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKLHHRmLRHFIAASVIVLTSSFLIFELVASDRAMSAYLRYIVQKADSSFLYDKYQNQSI AAHVMRALAAEQSEVSPEQRRAICEAFESANNTHGLNLTAHKYPGLRGTLQTASTDCDTI VEAAALLPAFDQAVEGNRHQDDYGSGLGMAEEKFHYYLDLNDRYVYFYEPVNVEYFAMNN WSFLQSGSIGIDRKDIEKVFTGRTVLSSIYQDQRTKQNVMSLLTPVYVAGQLKGIVLLDI NKNNLRNIFYTHDRPLLWRFLNVTLTDTDSGRDIIINQSEDNLFQYVSYVHDLPGGIRVS LSIDILYFITSSWKSVLFWILTALILLNMVRMHFRLYQNVSRENISDAMTGLYNRKILTP ELEQRLQKLVQSGSSVMFIAIDMDKLKQINDTLGHQEGDLAITLLAQAIKQSIRKSDYAI RLGGDEFCIILVDSTPQIAAQLPERIEKRLQHIAPQKEIGFSSGIYAMKENDTLHDAYKA SDERLYVNKQNKNSRS Protein Names:Recommended name: Putative diguanylate cyclase YeaJ Short name= DGC EC= 2.7.7.65 Gene Names:Name:yeaJ Ordered Locus Names:b1786, JW5291 Expression Region:1-496 Sequence Info:fµLl length protein

1,859.00 € 1859.0 EUR 1,859.00 €

1,859.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days