ELISA Recombinant Escherichia coli Putative uncharacterized protein b1142 (b1142, JW1128)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P75971 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVNAAQRTRVKVEADNRPSVDTHPPGVQPSPGTGGTRHHNFmLCVVLAVPVFSLVLSGTA LFTKQRRVSPDDGLITRPILIAVATGALLCFVEKLTDRAGSIC Protein Names:Recommended name: Putative uncharacterized protein b1142 Gene Names:Ordered Locus Names:b1142, JW1128 Expression Region:1-103 Sequence Info:fµLl length protein