Skip to Content

ELISA Recombinant Escherichia coli Hemolysin E, chromosomal(hlyE)

https://www.scicommhub.com/web/image/product.template/125790/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P77335 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVL VGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLD DGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGA AAGVVAGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKL KLTTEIAAIGEIKTETETTRFYVDYDDLmLSLLKEAAKKMINTCNEYQKRHGKKTLFEVP EV Protein Names:Recommended name: Hemolysin E, chromosomal Alternative name(s): Cytotoxin ClyA Hemolysis-inducing protein Latent pore-forming 34 kDa hemolysin Silent hemolysin SheA Gene Names:Name:hlyE Synonyms:clyA, hpr, sheA, ycgD Ordered Locus Names:b1182, JW5181 Expression Region:2-303 Sequence Info:fµLl length protein

1,654.00 € 1654.0 EUR 1,654.00 €

1,654.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days