ELISA Recombinant Escherichia coli Uncharacterized protein yniB(yniB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P76208 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTYQQAGRIAVLKRILGWVIFIPALISTLISLLKFMNTRQENKEGINAVmLDFTHVMIDM MQANTPFLNLFWYNSPTPNFNGGVNVMFWVIFILIFVGLALQDSGARMSRQARFLREGVE DQLILEKAKGEEGLTREQIESRIVVPHHTIFLQFFSLYILPVICIAAGYVFFSLLGFI Protein Names:Recommended name: Uncharacterized protein yniB Gene Names:Name:yniB Ordered Locus Names:b1726, JW1715 Expression Region:1-178 Sequence Info:fµLl length protein