ELISA Recombinant Escherichia coli Inner membrane protein ycdZ(ycdZ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P75916 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNILLSIAITTGILSGIWGWVAVSLGLLSWAGFLGCTAYFACPQGGLKGLAISAATLLSG VVWAMVIIYGSALAPHLEILGYVITGIVAFLMCIQAKQLLLSFVPGTFIGACATFAGQGD WKLVLPSLALGLIFGYAMKNSGLWLAARSAKTAHREQEIKNKA Protein Names:Recommended name: Inner membrane protein ycdZ Gene Names:Name:ycdZ Ordered Locus Names:b1036, JW5147 Expression Region:1-163 Sequence Info:fµLl length protein