ELISA Recombinant Escherichia coli Probable formate transporter 2(focB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P77733 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAP SSQALTHLVGGLCFTLGFILLAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGN LAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTFTESVSLGIMCNLMVCLALWM SYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPPPFWQLAHSSADN FPALTVSHFITANLLPVmLGNIIGGAVLVSMCYRAIYLRQEP Protein Names:Recommended name: Probable formate transporter 2 Alternative name(s): Formate channel 2 Gene Names:Name:focB Ordered Locus Names:b2492, JW2477 Expression Region:1-282 Sequence Info:fµLl length protein