ELISA Recombinant Escherichia coli Uncharacterized protein yahC(yahC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P77219 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSFYAAGGGKSGFIRSLA VNYSGMVWAFFAALTAGWLASVSGLSAFWASVITTVPFSAVVVWQGRFWLLSFIPGGFLG MTLFFASGMNWTVTLLGFLAGNCVGVISEYGGQKLSEATTKRDGY Protein Names:Recommended name: Uncharacterized protein yahC Gene Names:Name:yahC Ordered Locus Names:b0317, JW0309 Expression Region:1-165 Sequence Info:fµLl length protein