ELISA Recombinant Escherichia coli Putative inactive ferrous iron permease EfeU(efeU)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P75901 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFVPFLImLREGLEAALIVSLIASYLKRTQRGMXDCVMWIGVLLAAALCLGLGIFINETT GEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALV MMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAmLGLATAVVLGFLLYWGGIRLNLGAF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQ EAPSVSEVAVWFIYLIPALVAFALPPRAGATASRSA Protein Names:Recommended name: Putative inactive ferrous iron permease EfeU Alternative name(s): Putative Fe(2+) ion permease EfeU Gene Names:Name:efeU Synonyms:ycdN Ordered Locus Names:b4490, JW5141/JW1002 ORF Names:b1016/b1017 Expression Region:1-276 Sequence Info:fµLl length protein