ELISA Recombinant Tail-anchored protein insertion receptor WRB(WRB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O00258 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMRAEIQDMKQEL STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFYVLQAALMISLI WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS Protein Names:Recommended name: Tail-anchored protein insertion receptor WRB Alternative name(s): Congenital heart disease 5 protein Tryptophan-rich basic protein Short name= WRB Gene Names:Name:WRB Synonyms:CHD5 Expression Region:1-174 Sequence Info:FµLl length protein