ELISA Recombinant TYRO protein tyrosine kinase-binding protein(TYROBP)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O43914 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK Protein Names:Recommended name: TYRO protein tyrosine kinase-binding protein Alternative name(s): DNAX-activation protein 12 Killer-activating receptor-associated protein Short name= KAR-associated protein Gene Names:Name:TYROBP Synonyms:DAP12, KARAP Expression Region:22-113 Sequence Info:fµLl length protein