ELISA Recombinant Tetraspanin-6(TSPAN6)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:O43657
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIATGTVIILLGTFGCFATCRASAWmLKLYAMFLTLVFLVELVAAIVGFVFRHEIKN SFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL EDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV
Protein Names:Recommended name: Tetraspanin-6 Short name= Tspan-6 Alternative name(s): A15 homolog Putative NF-kappa-B-activating protein 321 T245 protein Tetraspanin TM4-D Transmembrane 4 superfamily member 6
Gene Names:Name:TSPAN6 Synonyms:TM4SF6 ORF Names:UNQ767/PRO1560
Expression Region:1-245
Sequence Info:FµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.