ELISA Recombinant Tetraspanin-6(TSPAN6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O43657 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIATGTVIILLGTFGCFATCRASAWmLKLYAMFLTLVFLVELVAAIVGFVFRHEIKN SFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL EDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV Protein Names:Recommended name: Tetraspanin-6 Short name= Tspan-6 Alternative name(s): A15 homolog Putative NF-kappa-B-activating protein 321 T245 protein Tetraspanin TM4-D Transmembrane 4 superfamily member 6 Gene Names:Name:TSPAN6 Synonyms:TM4SF6 ORF Names:UNQ767/PRO1560 Expression Region:1-245 Sequence Info:FµLl length protein