ELISA Recombinant Tetraspanin-3(TSPAN3)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:O60637
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYTLIPAVVIIAV GALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQ KVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETAS NCNGSLAHPSDLYAEGCEALVVKKLQEIMMHVIWAALAFAAIQLLGmLCACIVLCRRSRD PAYELLITGGTYA
Protein Names:Recommended name: Tetraspanin-3 Short name= Tspan-3 Alternative name(s): Tetraspanin TM4-A Transmembrane 4 superfamily member 8
Gene Names:Name:TSPAN3 Synonyms:TM4SF8
Expression Region:1-253
Sequence Info:FµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.