ELISA Recombinant Tetraspanin-13(TSPAN13)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O95857 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIA LVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARN DIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTE ILGVWLTYRYRNQKDPRANPSAFL Protein Names:Recommended name: Tetraspanin-13 Short name= Tspan-13 Alternative name(s): Tetraspan NET-6 Transmembrane 4 superfamily member 13 Gene Names:Name:TSPAN13 Synonyms:NET6, TM4SF13 ORF Names:UNQ260/PRO296 Expression Region:1-204 Sequence Info:FµLl length protein