ELISA Recombinant Tumor necrosis factor ligand superfamily member 14(TNFSF14)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O43557 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 14 Alternative name(s): Herpes virus entry mediator ligand Short name= HVEM-L Short name= Herpesvirus entry mediator ligand CD_antigen= CD258 Cleaved into the following 2 chains: 1. Tumor necrosis factor ligand superfamily member 14, membrane form 2. Tumor necrosis factor ligand superfamily member 14, soluble form Gene Names:Name:TNFSF14 Synonyms:HVEmL, LIGHT ORF Names:UNQ391/PRO726 Expression Region:1-240 Sequence Info:fµLl length protein