ELISA Recombinant Transmembrane protein 45A(TMEM45A)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9NWC5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGNFRGHALPGTFFFIIGLWWCTKSILKYICKKQKRTCYLGSKTLFYRLEILEGITIVGM ALTGMAGEQFIPGGPHLmLYDYKQGHWNQLLGWHHFTMYFFFGLLGVADILCFTISSLPV SLTKLmLSNALFVEAFIFYNHTHGREmLDIFVHQLLVLVVFLTGLVAFLEFLVRNNVLLE LLRSSLILLQGSWFFQIGFVLYPPSGGPAWDLMDHENILFLTICFCWHYAVTIVIVGMNY AFITWLVKSRLKRLCSSEVGLLKNAEREQESEEEM Protein Names:Recommended name: Transmembrane protein 45A Alternative name(s): DNA polymerase-transactivated protein 4 Dermal papilla-derived protein 7 Gene Names:Name:TMEM45A Synonyms:DERP7, DNAPTP4 Expression Region:1-275 Sequence Info:fµLl length protein