Skip to Content

ELISA Recombinant Transmembrane protein 185A(TMEM185A)

https://www.scicommhub.com/web/image/product.template/139960/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8NFB2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASV GTGVWARNPQYRAEGETCVEFKAmLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLF FVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDKIIHWPWLVVCVPLWILMS FLCLVVLYYIVWSVLFLRSMDVIAEQRRTHITMALSWMTIVVPLLTFEILLVHKLDGHNA FSCIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH HEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYVLPPPKLNIEMPD Protein Names:Recommended name: Transmembrane protein 185A Alternative name(s): Protein FAM11A Gene Names:Name:TMEM185A Synonyms:CXorf13, FAM11A Expression Region:1-350 Sequence Info:fµLl length protein

1,704.00 € 1704.0 EUR 1,704.00 €

1,704.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.