ELISA Recombinant TGF-beta receptor type-2(TGFBR2)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:P38551
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:IPPHVPKSVNSDMMVTDSNGAVKLPQLCKFCDVRSSTCDNQKSCLSNCSITAICEKPQEV CVAVWRKNDENITIETVCDDPKIAYHGFVLDDAASSKCIMKERKGSGETFFMCSCSSDEC NDHIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAIAVIITFYCYRVHRQQKLSPSWDS GKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKL RQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDL
Protein Names:Recommended name: TGF-beta receptor type-2 Short name= TGFR-2 EC= 2.7.11.30 Alternative name(s): TGF-beta type II receptor Transforming growth factor-beta receptor type II Short name= TGF-beta receptor type II Short name= TbetaR-II
Gene Names:Name:TGFBR2
Expression Region:24-297
Sequence Info:fµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.