ELISA Recombinant Transmembrane epididymal protein 1(TEDDM1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q5T9Z0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MILKGCLLYPLCSPRNKQRCARLWKIAYGGLLKIVTGSLLTFYVVLCLDGGMVLMRKQVP SRFMYPKEWQHLTMFILLTLNGCVDFMSKNVLPQRCVGLEKGTLVLIIYELLLLMVSHVK DSEGVELHVYSLLILVVFLLLLVLTAELWAPNMCHLQLMETFLILMMGSWLMQAGFILYR PVSGYPWQDDDISDIMFVTTFFCWHVMINASFLLGIYGFSSFWYHCFRPSLKLTGPKEAP YYASTPGPLYKLLQEVEQSEKEDQALLLPKSSP Protein Names:Recommended name: Transmembrane epididymal protein 1 Alternative name(s): epididymis-specific protein 9 Short name= He9 Gene Names:Name:TEDDM1 Synonyms:HE9 Expression Region:1-273 Sequence Info:fµLl length protein