Skip to Content

ELISA Recombinant Thromboxane-A synthase(TBXAS1)

https://www.scicommhub.com/web/image/product.template/149718/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:P47787 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEVLGFLSPELNGPMVTMALAVVLLALLKWYSTSAFSRLEKLGIRHPKPSPFIGNLTFFR QGFWESHMELRKQYGPLSGYYLGRRMIVVISDPDMIKQVLAEKFSNFTNRMATGLESKPV ADSILFLRDKRWEEVRSVLTSAFSPKKLNKLTPLISQACDLLLAHLERYAESGDAFDIQR CYCCYTTDVVASVAFGTQVNSSEEPEHPFVKHCRRFFAFSVPRLILVLILSFPSIMVPLA RILPNKKRDEVNGFFNKLIRNVIALRDQQAAEERRQDFLQMVLDLRHSAPSVGVENFDIV RQAFSSAKGCPADPSQPHLPRPLSKPLTVDEVVGQAFLFLIAGYEIITNTLSFVTYLLAT NPDCQEKLLREVDDFSKKHPSPEHCSLQQGLPYLDMVLSETLRMYPPAFRFTREAARDCE VLGQRIPAGTVLEVAVGALHHDPKHWPHPETFDPERFTAEAQRLQQPFTYLPFGAGPRSC LGVQLGLLEIKLTLLHILRKFRFEACPETQVPLQLESKSALSPKNGVYIRIVPR Protein Names:Recommended name: Thromboxane-A synthase Short name= TXA synthase Short name= TXS EC= 5.3.99.5 Alternative name(s): Cytochrome P450 5A1 Gene Names:Name:TBXAS1 Synonyms:CYP5, CYP5A1 Expression Region:1-534 Sequence Info:FµLl length protein

1,899.00 € 1899.0 EUR 1,899.00 €

1,899.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.