Skip to Content

ELISA Recombinant Substance-K receptor(TACR2)

https://www.scicommhub.com/web/image/product.template/129109/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P21452 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI Protein Names:Recommended name: Substance-K receptor Short name= SKR Alternative name(s): NK-2 receptor Short name= NK-2R Neurokinin A receptor Tachykinin receptor 2 Gene Names:Name:TACR2 Synonyms:NK2R, NKNAR, TAC2R Expression Region:1-398 Sequence Info:fµLl length protein

1,755.00 € 1755.0 EUR 1,755.00 €

1,755.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF023069HU

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.