ELISA Recombinant Trace amine-associated receptor 5(TAAR5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O14804 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGmLIIVLGNVFVAFAVS YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSL AGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE Protein Names:Recommended name: Trace amine-associated receptor 5 Short name= TaR-5 Short name= Trace amine receptor 5 Alternative name(s): Putative neurotransmitter receptor Gene Names:Name:TAAR5 Synonyms:PNR Expression Region:1-337 Sequence Info:FµLl length protein