Skip to Content

ELISA Recombinant Sterol regulatory element-binding protein 1(SREBF1)

https://www.scicommhub.com/web/image/product.template/149711/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:O97676 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDEPPFTEAALEQALAEPCELDAALLTDIEDmLQLINNQDSDFPGLFDAPYAGVAGGTDP TSPDASSPGSPTPPPSTMSSPLEGFLGGARTPPPPPVSPTQPAPTPLKMYPSVPAFSPGP GIKEEPVPLTILQPPTPQPLSGALLPQSLPALAPPQLSPAPVLGYPSPPGSFSSATPPGS TSQTLPGLPLASLPGVLPVSVHTQVQSAAPQQLLTATATPVVSPGTTTVTSQIQQVPVLL QPHFIKADSLLLTTMKTDMGTPVKAAGIGSLAPGTAVQAAPLQTLVSGGTILATVPLVVD TDKLPINRLAAGGKALSSGQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNK SAVLRKAIDYIRFLQQSNQKLKQENLSLRTAAHKSKSLKDLVSCSSGGRTDVPMEGVKPE VVDTLSPPPSDAGSPSQSSPLSLGSRGSSSGGSGSDSEPDSPVFEDSQMKPEQLPAPHGR GmLDRSRLAL Protein Names:Recommended name: Sterol regµLatory element-binding protein 1 Short name= SREBP-1 Alternative name(s): Adipocyte determination and differentiation-dependent factor 1 Sterol regµLatory element-binding transcription factor 1 Cleaved into Gene Names:Name:SREBF1 Synonyms:ADD1, SREBP1 Expression Region:1-490 Sequence Info:FµLl length protein

1,852.00 € 1852.0 EUR 1,852.00 €

1,852.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.