ELISA Recombinant Signal peptidase complex subunit 1(SPCS1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:B0FWK4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSC LLTLPPWPIYRRHPLKWLPVQDSGTEDKKPGERKIKRHAKNN Protein Names:Recommended name: Signal peptidase complex subunit 1 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 12 kDa subunit Short name= SPase 12 kDa subunit Gene Names:Name:SPCS1 Synonyms:SPC12 Expression Region:1-102 Sequence Info:FµLl length protein