Skip to Content

ELISA Recombinant Sterol O-acyltransferase 1(SOAT1)

https://www.scicommhub.com/web/image/product.template/139162/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P35610 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEE LKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGK IFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGK FPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPT YVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF LFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSAR VLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEmLRFGDRMFYKDWWNSTSYSNYYRTW NVVVHDWLYYYAYKDFLWFFSKRFKSAAmLAVFAVSAVVHEYALAVCLSFFYPVLFVLFM FFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVR PRSWTCRYVF Protein Names:Recommended name: Sterol O-acyltransferase 1 EC= 2.3.1.26 Alternative name(s): Acyl-coenzyme A:cholesterol acyltransferase 1 Short name= ACAT-1 Cholesterol acyltransferase 1 Gene Names:Name:SOAT1 Synonyms:ACACT, ACACT1, ACAT, ACAT1, SOAT, STAT Expression Region:1-550 Sequence Info:FµLl length protein

1,916.00 € 1916.0 EUR 1,916.00 €

1,916.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.