ELISA Recombinant Sodium-glucose cotransporter 2(SLC5A2),partial

Quantity: 10µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 15-20 working days Research Topic: Signal Transduction Uniprot ID: P31639 Gene Names: SLC5A2 Organism: Homo sapiens () AA Sequence: MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA Expression Region: 1-102aa Sequence Info: Partial Source: in vitro E.coli expression system Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged MW: 30.5 kDa Alternative Name(s): Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2 Relevance: Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubµLes. Reference: "Novel compound heterozygous mutations in SLC5A2 are responsible for autosomal recessive renal glucosuria." Calado J., Soto K., Clemente C., Correia P., Rueff J. Hum. Genet. 114:314-316(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.