ELISA Recombinant Solute carrier family 2, facilitated glucose transporter member 2(SLC2A2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:O62786 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:VCAIFMSVGLVLLDKLPWMSYVSMTAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPAALA MAAFSNWTRNFIIALCFQYIADFCGPYVFFLFAGVVLVFTLFTFFKVPETKGKSFEEIAA Protein Names:Recommended name: Solute carrier family 2, facilitated glucose transporter member 2 Alternative name(s): Glucose transporter type 2, liver Short name= GLUT-2 Gene Names:Name:SLC2A2 Synonyms:GLUT2 Expression Region:1-120 Sequence Info:FµLl length protein