ELISA Recombinant Succinate dehydrogenase cytochrome b560 subunit, mitochondrial(SDHC)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sus scrofa (Pig)
Uniprot NO.:D0VWV4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LGTTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSA LLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLT QSGVVVLILTVLSSVGLAAM
Protein Names:Recommended name: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial Alternative name(s): Succinate-ubiquinone oxidoreductase cytochrome B large subunit Short name= CYBL
Gene Names:Name:SDHC
Expression Region:30-169
Sequence Info:FµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.