ELISA Recombinant Sphingosine 1-phosphate receptor 2(S1PR2)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:O95136
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV FSLLAIAIERHVAIAKVKLYGSDKSCRmLLLIGASWLISLVLGGLPILGWNCLGHLEACS TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
Protein Names:Recommended name: Sphingosine 1-phosphate receptor 2 Short name= S1P receptor 2 Short name= S1P2 Alternative name(s): Endothelial differentiation G-protein coupled receptor 5 Sphingosine 1-phosphate receptor Edg-5 Short name=
Gene Names:Name:S1PR2 Synonyms:EDG5
Expression Region:1-353
Sequence Info:FµLl length protein
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.