ELISA Recombinant Formosania lacustre NADH-ubiquinone oxidoreductase chain 3(MT-ND3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Formosania lacustre (Oriental stream loach) (Crossostoma lacustre) Uniprot NO.:P34192 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLVISILAITIILSSILAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSIRFFLVA ILFLLFDLEIALLLALPWGDQLYSATGTFFWATAVLILLTLGLIYEWTQGGLEWAE Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 3 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 3 Gene Names:Name:MT-ND3 Synonyms:MTND3, NADH3, ND3 Expression Region:1-116 Sequence Info:fµLl length protein