ELISA Recombinant Eulemur macaco Cytochrome c oxidase subunit 2(MT-CO2)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:EµLemur macaco (Black lemur) (Petterus macaco)
Uniprot NO.:P98033
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAYPVQLGFQDAASPIMEELLYFHDHTLMIMFLISSLVLYIISLmLTTELIHTSTMDAQE VETVWTILPAVILILIALPSLRILYMMDEISTPSLTLKTMGHQWYWSYEYTDYENLCFDS YMAPPSDLKPGELRLLEVDNRVVLPTELPIRmLISSEDVLHSWTIPSLGVKTDAIPGRLN QATLMASRPGVYYGQCSEICGANHSFMPIVLELVPLKHFEEWLLSmL
Protein Names:Recommended name: Cytochrome c oxidase subunit 2 Alternative name(s): Cytochrome c oxidase polypeptide II
Gene Names:Name:MT-CO2 Synonyms:COII, COXII, MTCO2
Expression Region:1-227
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF015073EJG
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.