Skip to Content

ELISA Recombinant Escherichia coli O45:K1 ATP synthase subunit a(atpB)

https://www.scicommhub.com/web/image/product.template/126867/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O45:K1 (strain S88 / ExPEC) Uniprot NO.:B7MGF8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASENMTPQDYIGHHLNNLQLDLRTFSLVDPHNPPATFWTINIDSMFFSVVLGLLFLVLF RSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6 Gene Names:Name:atpB Ordered Locus Names:ECS88_4160 Expression Region:1-271 Sequence Info:fµLl length protein

1,621.00 € 1621.0 EUR 1,621.00 €

1,621.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF015070EOK

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.