ELISA Recombinant Serine protease HTRA2, mitochondrial(HTRA2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O43464 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLI VTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQ GEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNL DGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMmLTLSPSI LAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRT QSQLAVQIRRGRETLTLYVTPEVTE Protein Names:Recommended name: Serine protease HTRA2, mitochondrial EC= 3.4.21.108 Alternative name(s): High temperature requirement protein A2 Short name= HtrA2 Omi stress-regµLated endoprotease Serine protease 25 Serine proteinase O Gene Names:Name:HTRA2 Synonyms:OMI, PRSS25 Expression Region:134-458 Sequence Info:FµLl length protein