ELISA Recombinant Serine protease hepsin(HPN)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P05981 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDR Protein Names:Recommended name: Serine protease hepsin EC= 3.4.21.106 Alternative name(s): Transmembrane protease serine 1 Cleaved into the following 2 chains: 1. Serine protease hepsin non-catalytic chain 2. Serine protease hepsin catalytic chain Gene Names:Name:HPN Synonyms:TMPRSS1 Expression Region:1-162 Sequence Info:fµLl length protein