Skip to Content

ELISA Recombinant Short-chain dehydrogenase-reductase 3(DHRS3)

https://www.scicommhub.com/web/image/product.template/138789/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O75911 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL VNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRmLELQNGHIVCLNSVLALS AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP LKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQAALEEIHKFSGTYTCMNTFKG RT Protein Names:Recommended name: Short-chain dehydrogenase/reductase 3 EC= 1.1.1.300 Alternative name(s): DD83.1 Retinal short-chain dehydrogenase/reductase 1 Short name= retSDR1 Gene Names:Name:DHRS3 ORF Names:UNQ2424/PRO4983 Expression Region:1-302 Sequence Info:FµLl length protein

1,654.00 € 1654.0 EUR 1,654.00 €

1,654.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.