Skip to Content

ELISA Recombinant Sphingolipid delta(4)-desaturase DES1(DEGS1)

https://www.scicommhub.com/web/image/product.template/139048/image_1920?unique=18ea82b
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O15121 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIV KDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYS ISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKP ITYLEVINTVAQVTFDILIYYFLGIKSLVYmLAASLLGLGLHPISGHFIAEHYMFLKGHE TYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFV MDDTISPYSRMKRHQKGEMVLE Protein Names:Recommended name: Sphingolipid delta(4)-desaturase DES1 EC= 1.14.-.- Alternative name(s): Cell migration-inducing gene 15 protein Degenerative spermatocyte homolog 1 Membrane lipid desaturase Gene Names:Name:DEGS1 Synonyms:DES1, mLD ORF Names:MIG15 Expression Region:2-323 Sequence Info:FµLl length protein

1,675.00 € 1675.0 EUR 1,675.00 €

1,675.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.