ELISA Recombinant Escherichia coli Protoheme IX farnesyltransferase(cyoE)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12 / DH10B) Uniprot NO.:B1XFL6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVGVSLVVASGCVFNNYI DRDIDRKMERTKNRVLVKGLISPAVSLVYATLLGIAGFmLLWFGANPLACWLGVMGFVVY VGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGEFDSGAAILLAIFSLWQMPHSYAI AIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLmLSLGGYAGYKYLVVAAAV SVWWLGMALRGYKVADDRIWARKLFGFSIIAITALSVMMSVDFMVPDSHTLLAAVW Protein Names:Recommended name: Protoheme IX farnesyltransferase EC= 2.5.1.- Alternative name(s): Heme B farnesyltransferase Heme O synthase Gene Names:Name:cyoE Ordered Locus Names:ECDH10B_0384 Expression Region:1-296 Sequence Info:fµLl length protein