ELISA Recombinant Serine-rich and transmembrane domain-containing protein 1(SERTM1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:A2A2V5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLI IALQRLKNIISSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS Protein Names:Recommended name: Serine-rich and transmembrane domain-containing protein 1 Gene Names:Name:SERTM1 Synonyms:C13orf36 Expression Region:1-107 Sequence Info:FµLl length protein