ELISA Recombinant UPF0197 transmembrane protein C11orf10(C11orf10)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P61165 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV Protein Names:Recommended name: UPF0197 transmembrane protein C11orf10 Gene Names:Name:C11orf10 ORF Names:HSPC005 Expression Region:1-79 Sequence Info:FµLl length protein