ELISA Recombinant Fervidobacterium nodosum ATP synthase subunit b(atpF)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Uniprot NO.:A7HJW1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDFFEINLTAVVQLLNFLFLLWILNKLLYKPFLGMMEKRKEKIEGEIVEAEKLRKQAEEI KKNAEEELKNARIRAEQIIASANSESEKIVEEAKQKAQKEAEKILQNAYLEIEKQKQEAL AQVQTIATELAINLAMKVLKGTLDEKAKREYLAKVIKEYEK
Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b
Gene Names:Name:atpF Ordered Locus Names:Fnod_0329
Expression Region:1-161
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF002358FDS
Our Product !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.