Skip to Content

ELISA Recombinant Fervidobacterium nodosum ATP synthase subunit b(atpF)

https://www.scicommhub.com/web/image/product.template/127431/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) Uniprot NO.:A7HJW1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDFFEINLTAVVQLLNFLFLLWILNKLLYKPFLGMMEKRKEKIEGEIVEAEKLRKQAEEI KKNAEEELKNARIRAEQIIASANSESEKIVEEAKQKAQKEAEKILQNAYLEIEKQKQEAL AQVQTIATELAINLAMKVLKGTLDEKAKREYLAKVIKEYEK Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b Gene Names:Name:atpF Ordered Locus Names:Fnod_0329 Expression Region:1-161 Sequence Info:fµLl length protein

1,505.00 € 1505.0 EUR 1,505.00 €

1,505.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF002358FDS

Our Product !

Check out what's  in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.