ELISA Recombinant Exiguobacterium sibiricum ATP synthase subunit b(atpF)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Uniprot NO.:B1YMR8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLTYRAAEGVAESNHLLLANMIVTIVVFLLLLILLKKFAWGPLVNMMKAREEHVASEIN SAEKSRKDAEVYVEQQQAELNKARTEARDLLEASRRQAEAEQARAMEQARVETELSKEEA RRAIERERAEAQAALKNDVALQAIAAARHVMKTQLATDEAAQRALVDQFLADTKGTN
Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b
Gene Names:Name:atpF Ordered Locus Names:Exig_2680
Expression Region:1-177
Sequence Info:fµLl length protein