ELISA Recombinant Serine-threonine-protein kinase PAK 7(PAK7),partial

Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 25-35 working days Research Topic: Cancer Uniprot ID: Q8TB93 Gene Names: PAK7 Organism: Homo sapiens () AA Sequence: MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ Expression Region: 1-293aa Sequence Info: Partial Source: BacµLovirus Tag Info: N-terminal 6xHis-tagged MW: 34.9 kDa Alternative Name(s): p21-activated kinase 5 Short name: PAK-5 p21-activated kinase 7 Short name: PAK-7 Relevance: Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regµLation, cell migration, proliferation or cell survival. Activation by various effectors including growth factor receptors or active CDC42 and RAC1 resµLts in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates the proto-oncogene RAF1 and stimµLates its kinase activity. Promotes cell survival by phosphorylating the BCL2 antagonist of cell death BAD. Phosphorylates CTNND1, probably to regµLate cytoskeletal organization and cell morphology. Keeps microtubµLes stable throµgh MARK2 inhibition and destabilizes the F-actin network leading to the disappearance of stress fibers and focal adhesions. Reference: "p21-Activated kinase 5 (Pak5) localizes to mitochondria and inhibits apoptosis by phosphorylating BAD."Cotteret S., Jaffer Z.M., Beeser A., Chernoff J.Mol. Cell. Biol. 23:5526-5539(2003) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.